SLAMF7 purified MaxPab mouse polyclonal antibody (B01P) View larger

SLAMF7 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLAMF7 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about SLAMF7 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00057823-B01P
Product name: SLAMF7 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human SLAMF7 protein.
Gene id: 57823
Gene name: SLAMF7
Gene alias: 19A|CD319|CRACC|CS1
Gene description: SLAM family member 7
Genbank accession: BC027867
Immunogen: SLAMF7 (AAH27867, 1 a.a. ~ 296 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAGSPTCLTLIYILWQLTGSAASGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSMVLLCLPLVPLLLSLFVLGLFLWFLKRERQEENNPKGRSSKYGLLHCGNTEKDGKSPLTAHDARHTKAICL
Protein accession: AAH27867
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00057823-B01P-13-15-1.jpg
Application image note: Western Blot analysis of SLAMF7 expression in transfected 293T cell line (H00057823-T01) by SLAMF7 MaxPab polyclonal antibody.

Lane 1: SLAMF7 transfected lysate(32.67 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SLAMF7 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart