GRHL3 monoclonal antibody (M01), clone 3C5 View larger

GRHL3 monoclonal antibody (M01), clone 3C5

H00057822-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GRHL3 monoclonal antibody (M01), clone 3C5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about GRHL3 monoclonal antibody (M01), clone 3C5

Brand: Abnova
Reference: H00057822-M01
Product name: GRHL3 monoclonal antibody (M01), clone 3C5
Product description: Mouse monoclonal antibody raised against a partial recombinant GRHL3.
Clone: 3C5
Isotype: IgG2a Kappa
Gene id: 57822
Gene name: GRHL3
Gene alias: MGC46624|SOM|TFCP2L4
Gene description: grainyhead-like 3 (Drosophila)
Genbank accession: NM_021180
Immunogen: GRHL3 (NP_067003, 101 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: YETDLTPLESPTHLMKFLTENVSGTPEYPDLLKKNNLMSLEGALPTPGKAAPLPAGPSKLEAGSVDSYLLPTTDMYDNGSLNSLFESIHGVPPTQRWQPD
Protein accession: NP_067003
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00057822-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00057822-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged GRHL3 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GRHL3 monoclonal antibody (M01), clone 3C5 now

Add to cart