Cart 151 Product Products 66 214,78 € (empty)
No products
To be determined Shipping
66 214,78 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 151 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 66 214,78 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 66 214,78 €
Data sheet of CCNB1IP1 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about CCNB1IP1 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00057820-B01P |
| Product name: | CCNB1IP1 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human CCNB1IP1 protein. |
| Gene id: | 57820 |
| Gene name: | CCNB1IP1 |
| Gene alias: | C14orf18|HEI10 |
| Gene description: | cyclin B1 interacting protein 1 |
| Genbank accession: | NM_182849.1 |
| Immunogen: | CCNB1IP1 (NP_878269.1, 1 a.a. ~ 277 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MSLCEDMLLCNYRKCRIKLSGYAWVTACSHIFCDQHGSGEFSRSPAICPACNSTLSGKLDIVRTELSPSEEYKAMVLAGLRPEIVLDISSRALAFWTYQVHQERLYQEYNFSKAEGHLKQMEKIYTQQIQSKDVELTSMKGEVTSMKKVLEEYKKKFSDISEKLMERNRQYQKLQGLYDSLRLRNITIANHEGTLEPSMIAQSGVLGFPLGNNSKFPLDNTPVRNRGDGDGDFQFRPFFAGSPTAPEPSNSFFSFVSPSRELEQQQVSSRAFKVKRI |
| Protein accession: | NP_878269.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of CCNB1IP1 expression in transfected 293T cell line (H00057820-T02) by CCNB1IP1 MaxPab polyclonal antibody. Lane 1: CCNB1IP1 transfected lysate(30.47 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |