HAMP monoclonal antibody (M02), clone 1F9 View larger

HAMP monoclonal antibody (M02), clone 1F9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HAMP monoclonal antibody (M02), clone 1F9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about HAMP monoclonal antibody (M02), clone 1F9

Brand: Abnova
Reference: H00057817-M02
Product name: HAMP monoclonal antibody (M02), clone 1F9
Product description: Mouse monoclonal antibody raised against a full length recombinant HAMP.
Clone: 1F9
Isotype: IgG1 Kappa
Gene id: 57817
Gene name: HAMP
Gene alias: HEPC|HEPCIDIN|HFE2B|LEAP-1|LEAP1|PLTR
Gene description: hepcidin antimicrobial peptide
Genbank accession: BC020612
Immunogen: HAMP (AAH20612, 25 a.a. ~ 84 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICIFCCGCCHRSKCGMCCKT
Protein accession: AAH20612
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00057817-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (32.34 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00057817-M02-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged HAMP is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HAMP monoclonal antibody (M02), clone 1F9 now

Add to cart