H00057804-M10_100ug
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00057804-M10 |
Product name: | POLD4 monoclonal antibody (M10), clone 2C11 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant POLD4. |
Clone: | 2C11 |
Isotype: | IgG2a Kappa |
Gene id: | 57804 |
Gene name: | POLD4 |
Gene alias: | POLDS|p12 |
Gene description: | polymerase (DNA-directed), delta 4 |
Genbank accession: | BC001334 |
Immunogen: | POLD4 (AAH01334, 1 a.a. ~ 34 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MGRKRLITDSYPVVKRREGPAGHSKGELAPELGL |
Protein accession: | AAH01334 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (29.48 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged POLD4 is approximately 1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |