POLD4 monoclonal antibody (M10), clone 2C11 View larger

POLD4 monoclonal antibody (M10), clone 2C11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of POLD4 monoclonal antibody (M10), clone 2C11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about POLD4 monoclonal antibody (M10), clone 2C11

Brand: Abnova
Reference: H00057804-M10
Product name: POLD4 monoclonal antibody (M10), clone 2C11
Product description: Mouse monoclonal antibody raised against a full length recombinant POLD4.
Clone: 2C11
Isotype: IgG2a Kappa
Gene id: 57804
Gene name: POLD4
Gene alias: POLDS|p12
Gene description: polymerase (DNA-directed), delta 4
Genbank accession: BC001334
Immunogen: POLD4 (AAH01334, 1 a.a. ~ 34 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MGRKRLITDSYPVVKRREGPAGHSKGELAPELGL
Protein accession: AAH01334
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00057804-M10-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (29.48 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00057804-M10-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged POLD4 is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy POLD4 monoclonal antibody (M10), clone 2C11 now

Add to cart