GATAD1 polyclonal antibody (A01) View larger

GATAD1 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GATAD1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about GATAD1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00057798-A01
Product name: GATAD1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant GATAD1.
Gene id: 57798
Gene name: GATAD1
Gene alias: FLJ22489|FLJ40695|ODAG|RG083M05.2
Gene description: GATA zinc finger domain containing 1
Genbank accession: NM_021167
Immunogen: GATAD1 (NP_066990, 82 a.a. ~ 190 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: KQSKQEIHRRSARLRNTKYKSAPAAEKKVSTKGKGRRHIFKLKNPIKAPESVSTIITAESIFYKGVYYQIGDVVSVIDEQDGKPYYAQIRGFIQDQYCEKSAALTWLIP
Protein accession: NP_066990
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00057798-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.1 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00057798-A01-1-35-1.jpg
Application image note: GATAD1 polyclonal antibody (A01), Lot # 051004JC01 Western Blot analysis of GATAD1 expression in Y-79 ( Cat # L042V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GATAD1 polyclonal antibody (A01) now

Add to cart