RBAK monoclonal antibody (M01), clone 6F9 View larger

RBAK monoclonal antibody (M01), clone 6F9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RBAK monoclonal antibody (M01), clone 6F9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about RBAK monoclonal antibody (M01), clone 6F9

Brand: Abnova
Reference: H00057786-M01
Product name: RBAK monoclonal antibody (M01), clone 6F9
Product description: Mouse monoclonal antibody raised against a partial recombinant RBAK.
Clone: 6F9
Isotype: IgG2a Kappa
Gene id: 57786
Gene name: RBAK
Gene alias: ZNF769
Gene description: RB-associated KRAB zinc finger
Genbank accession: NM_021163
Immunogen: RBAK (NP_066986, 51 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TTKPNVIIKLEQGEEPWIMGGEFPCQHSPEAWRVDDLIERIQENEDKHSRQAACINSKTLTEEKENTFSQIYMETSLVPSSIIAHNCVSCGKNLESISQL
Protein accession: NP_066986
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00057786-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00057786-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged RBAK is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RBAK monoclonal antibody (M01), clone 6F9 now

Add to cart