ANKRA2 monoclonal antibody (M01), clone 1D11 View larger

ANKRA2 monoclonal antibody (M01), clone 1D11

H00057763-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ANKRA2 monoclonal antibody (M01), clone 1D11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about ANKRA2 monoclonal antibody (M01), clone 1D11

Brand: Abnova
Reference: H00057763-M01
Product name: ANKRA2 monoclonal antibody (M01), clone 1D11
Product description: Mouse monoclonal antibody raised against a partial recombinant ANKRA2.
Clone: 1D11
Isotype: IgG1 Kappa
Gene id: 57763
Gene name: ANKRA2
Gene alias: ANKRA
Gene description: ankyrin repeat, family A (RFXANK-like), 2
Genbank accession: NM_023039
Immunogen: ANKRA2 (NP_075526, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MDTSTNLDIGAQLIVEECPSTYSLTGMPDIKIEHPLDPNSEEGSAQGVAMGMKFILPNRFDMNVCSRFVKSLNEEDSKNIQDQVNSDLEVASVLFKAE
Protein accession: NP_075526
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00057763-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00057763-M01-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to ANKRA2 on HeLa cell. [antibody concentration 10 ug/ml]
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ANKRA2 monoclonal antibody (M01), clone 1D11 now

Add to cart