H00057763-M01_100ug
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00057763-M01 |
Product name: | ANKRA2 monoclonal antibody (M01), clone 1D11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ANKRA2. |
Clone: | 1D11 |
Isotype: | IgG1 Kappa |
Gene id: | 57763 |
Gene name: | ANKRA2 |
Gene alias: | ANKRA |
Gene description: | ankyrin repeat, family A (RFXANK-like), 2 |
Genbank accession: | NM_023039 |
Immunogen: | ANKRA2 (NP_075526, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MDTSTNLDIGAQLIVEECPSTYSLTGMPDIKIEHPLDPNSEEGSAQGVAMGMKFILPNRFDMNVCSRFVKSLNEEDSKNIQDQVNSDLEVASVLFKAE |
Protein accession: | NP_075526 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunofluorescence of monoclonal antibody to ANKRA2 on HeLa cell. [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |