Brand: | Abnova |
Reference: | H00057761-M03 |
Product name: | TRIB3 monoclonal antibody (M03), clone 1H2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TRIB3. |
Clone: | 1H2 |
Isotype: | IgG1 Kappa |
Gene id: | 57761 |
Gene name: | TRIB3 |
Gene alias: | C20orf97|NIPK|SINK|SKIP3|TRB3 |
Gene description: | tribbles homolog 3 (Drosophila) |
Genbank accession: | BC027484 |
Immunogen: | TRIB3 (AAH27484, 56 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PDRATAVATASRLGPYVLLEPEEGGRAYRALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHVARPTEVLAGTQLLYAFFTRTHGDMH |
Protein accession: | AAH27484 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to TRIB3 on A-431 cell. [antibody concentration 10 ug/ml] |
Applications: | IF,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Shipping condition: | Dry Ice |