TRIB3 monoclonal antibody (M03), clone 1H2 View larger

TRIB3 monoclonal antibody (M03), clone 1H2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TRIB3 monoclonal antibody (M03), clone 1H2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA,WB-Re,WB-Tr,RNAi-Ab

More info about TRIB3 monoclonal antibody (M03), clone 1H2

Brand: Abnova
Reference: H00057761-M03
Product name: TRIB3 monoclonal antibody (M03), clone 1H2
Product description: Mouse monoclonal antibody raised against a partial recombinant TRIB3.
Clone: 1H2
Isotype: IgG1 Kappa
Gene id: 57761
Gene name: TRIB3
Gene alias: C20orf97|NIPK|SINK|SKIP3|TRB3
Gene description: tribbles homolog 3 (Drosophila)
Genbank accession: BC027484
Immunogen: TRIB3 (AAH27484, 56 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PDRATAVATASRLGPYVLLEPEEGGRAYRALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHVARPTEVLAGTQLLYAFFTRTHGDMH
Protein accession: AAH27484
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00057761-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.53 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00057761-M03-4-4-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to TRIB3 on A-431 cell. [antibody concentration 10 ug/ml]
Applications: IF,ELISA,WB-Re,WB-Tr,RNAi-Ab
Shipping condition: Dry Ice

Reviews

Buy TRIB3 monoclonal antibody (M03), clone 1H2 now

Add to cart