GBA3 purified MaxPab mouse polyclonal antibody (B01P) View larger

GBA3 purified MaxPab mouse polyclonal antibody (B01P)

H00057733-B01P_50ug

New product

395,00 € tax excl.

50 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GBA3 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about GBA3 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00057733-B01P
Product name: GBA3 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human GBA3 protein.
Gene id: 57733
Gene name: GBA3
Gene alias: CBGL1|GLUC|KLrP|MGC104276|MGC126878
Gene description: glucosidase, beta, acid 3 (cytosolic)
Genbank accession: BC029362.1
Immunogen: GBA3 (AAH29362.1, 1 a.a. ~ 162 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAFPAGFGWAAATAAYQVEGGWDADGKGPCVWDTFTHQGGERVFKNQTGDVACGSYTLWEEDLKCIKQLGLTHYRFSLSWSRLLPDGTTGFINQKAIQLDKVNLQVYCAWSLLDNFEWNQGYSSRFGLFHVDFEDPARPRVPYTSAKEYAKIIRNNGLEAHL
Protein accession: AAH29362.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00057733-B01P-13-15-1.jpg
Application image note: Western Blot analysis of GBA3 expression in transfected 293T cell line (H00057733-T01) by GBA3 MaxPab polyclonal antibody.

Lane 1: GBA3 transfected lysate(17.82 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy GBA3 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart