GBA3 polyclonal antibody (A01) View larger

GBA3 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GBA3 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about GBA3 polyclonal antibody (A01)

Brand: Abnova
Reference: H00057733-A01
Product name: GBA3 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant GBA3.
Gene id: 57733
Gene name: GBA3
Gene alias: CBGL1|GLUC|KLrP|MGC104276|MGC126878
Gene description: glucosidase, beta, acid 3 (cytosolic)
Genbank accession: NM_020973
Immunogen: GBA3 (NP_066024, 402 a.a. ~ 468 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: KAIQLDKVNLQVYCAWSLLDNFEWNQGYSSRFGLFHVDFEDPARPRVPYTSAKEYAKIIRNNGLEAH
Protein accession: NP_066024
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00057733-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.48 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GBA3 polyclonal antibody (A01) now

Add to cart