NCOA5 monoclonal antibody (M04), clone 1E9 View larger

NCOA5 monoclonal antibody (M04), clone 1E9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NCOA5 monoclonal antibody (M04), clone 1E9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about NCOA5 monoclonal antibody (M04), clone 1E9

Brand: Abnova
Reference: H00057727-M04
Product name: NCOA5 monoclonal antibody (M04), clone 1E9
Product description: Mouse monoclonal antibody raised against a full length recombinant NCOA5.
Clone: 1E9
Isotype: IgG2b Kappa
Gene id: 57727
Gene name: NCOA5
Gene alias: CIA|bA465L10.6
Gene description: nuclear receptor coactivator 5
Genbank accession: BC056872
Immunogen: NCOA5 (AAH56872, 1 a.a. ~ 315 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAGMPGTAETFETPETCGTTDMRDSRDPMYRREGSYDRYLRMDDYCRRKDDSYFDRYRDSFDGRGPPGPESQSRAKERLKREERRREELYRQYFEEIQRRFDAERPVDCSVIVVNKQTKDYAESVGRKVRDLGMVVDLIFLNTEVSLSQALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQEHRNMPQADAMVLVARNYERYKNECREKEREEIARQAAKMADEAILQERERGGPEEGVRGGHPPAIQSLINLLADNRYLTAEETDKIINYLRERKERLMRSSTDSLPGELRGRAEARFPANHSGRPRVPR
Protein accession: AAH56872
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00057727-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (60.39 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00057727-M04-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged NCOA5 is approximately 3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy NCOA5 monoclonal antibody (M04), clone 1E9 now

Add to cart