NOPE monoclonal antibody (M03), clone 6E6 View larger

NOPE monoclonal antibody (M03), clone 6E6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NOPE monoclonal antibody (M03), clone 6E6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about NOPE monoclonal antibody (M03), clone 6E6

Brand: Abnova
Reference: H00057722-M03
Product name: NOPE monoclonal antibody (M03), clone 6E6
Product description: Mouse monoclonal antibody raised against a partial recombinant NOPE.
Clone: 6E6
Isotype: IgG2a Kappa
Gene id: 57722
Gene name: IGDCC4
Gene alias: DDM36|FLJ42051|KIAA1628|NOPE
Gene description: immunoglobulin superfamily, DCC subclass, member 4
Genbank accession: NM_020962
Immunogen: NOPE (NP_066013, 1152 a.a. ~ 1250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DLEPEDPLPPEAPDLISGVGDPGQGAAWLDRELGGCELAAPGPDRLTCLPEAASASCSYPDLQPGEVLEETPGDSCQLKSPCPLGASPGLPRSPVSSSA
Protein accession: NP_066013
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00057722-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00057722-M03-1-1-1.jpg
Application image note: NOPE monoclonal antibody (M03), clone 6E6 Western Blot analysis of NOPE expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Neighbor of punc E11, a novel onco-fetal marker for hepatocellular carcinoma.Marquardt JU, Quasdorff M, Varnholt H, Curth HM, Mesghenna S, Protzer U, Goeser T, Nierhoff D.
Int J Cancer. 2010 Jul 23. [Epub ahead of print]

Reviews

Buy NOPE monoclonal antibody (M03), clone 6E6 now

Add to cart