SEMA4G monoclonal antibody (M01), clone 3F2 View larger

SEMA4G monoclonal antibody (M01), clone 3F2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SEMA4G monoclonal antibody (M01), clone 3F2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about SEMA4G monoclonal antibody (M01), clone 3F2

Brand: Abnova
Reference: H00057715-M01
Product name: SEMA4G monoclonal antibody (M01), clone 3F2
Product description: Mouse monoclonal antibody raised against a partial recombinant SEMA4G.
Clone: 3F2
Isotype: IgG2a Kappa
Gene id: 57715
Gene name: SEMA4G
Gene alias: FLJ20590|KIAA1619|MGC102867
Gene description: sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4G
Genbank accession: NM_017893
Immunogen: SEMA4G (NP_060363, 24 a.a. ~ 115 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RRPSRELDATPRMTIPYEELSGTRHFKGQAQNYSTLLLEEASARLLVGARGALFSLSANDIGDGAHKEIHWEASPEMQSKCHQKGKNNQTEC
Protein accession: NP_060363
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00057715-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.86 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SEMA4G monoclonal antibody (M01), clone 3F2 now

Add to cart