Brand: | Abnova |
Reference: | H00057715-M01 |
Product name: | SEMA4G monoclonal antibody (M01), clone 3F2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SEMA4G. |
Clone: | 3F2 |
Isotype: | IgG2a Kappa |
Gene id: | 57715 |
Gene name: | SEMA4G |
Gene alias: | FLJ20590|KIAA1619|MGC102867 |
Gene description: | sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4G |
Genbank accession: | NM_017893 |
Immunogen: | SEMA4G (NP_060363, 24 a.a. ~ 115 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RRPSRELDATPRMTIPYEELSGTRHFKGQAQNYSTLLLEEASARLLVGARGALFSLSANDIGDGAHKEIHWEASPEMQSKCHQKGKNNQTEC |
Protein accession: | NP_060363 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.86 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |