CPNE5 monoclonal antibody (M02A), clone 2G4 View larger

CPNE5 monoclonal antibody (M02A), clone 2G4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CPNE5 monoclonal antibody (M02A), clone 2G4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about CPNE5 monoclonal antibody (M02A), clone 2G4

Brand: Abnova
Reference: H00057699-M02A
Product name: CPNE5 monoclonal antibody (M02A), clone 2G4
Product description: Mouse monoclonal antibody raised against a partial recombinant CPNE5.
Clone: 2G4
Isotype: IgG1 Kappa
Gene id: 57699
Gene name: CPNE5
Gene alias: COPN5|CPN5|DKFZp666C234|KIAA1599
Gene description: copine V
Genbank accession: NM_020939
Immunogen: CPNE5 (NP_065990, 393 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RVSHEFPLNGNQENPSCCGIDGILEAYHRSLRTVQLYGPTNFAPVVTHVARNAAAVQD
Protein accession: NP_065990
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00057699-M02A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (32.12 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CPNE5 monoclonal antibody (M02A), clone 2G4 now

Add to cart