Brand: | Abnova |
Reference: | H00057699-M02A |
Product name: | CPNE5 monoclonal antibody (M02A), clone 2G4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CPNE5. |
Clone: | 2G4 |
Isotype: | IgG1 Kappa |
Gene id: | 57699 |
Gene name: | CPNE5 |
Gene alias: | COPN5|CPN5|DKFZp666C234|KIAA1599 |
Gene description: | copine V |
Genbank accession: | NM_020939 |
Immunogen: | CPNE5 (NP_065990, 393 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RVSHEFPLNGNQENPSCCGIDGILEAYHRSLRTVQLYGPTNFAPVVTHVARNAAAVQD |
Protein accession: | NP_065990 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (32.12 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |