TNRC6C monoclonal antibody (M14), clone 3C4 View larger

TNRC6C monoclonal antibody (M14), clone 3C4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TNRC6C monoclonal antibody (M14), clone 3C4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about TNRC6C monoclonal antibody (M14), clone 3C4

Brand: Abnova
Reference: H00057690-M14
Product name: TNRC6C monoclonal antibody (M14), clone 3C4
Product description: Mouse monoclonal antibody raised against a partial recombinant TNRC6C.
Clone: 3C4
Isotype: IgG2a Kappa
Gene id: 57690
Gene name: TNRC6C
Gene alias: FLJ20015|KIAA1582
Gene description: trinucleotide repeat containing 6C
Genbank accession: NM_018996
Immunogen: TNRC6C (NP_061869.2, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MATGSAQGNFTGHTKKTNGNNGTNGALVQSPSNQSALGAGGANSNGSAARVWGVATGSSSGLAHCSVSGGDGKMDTMIGDGRSQNCWGASNSNAGINLNL
Protein accession: NP_061869.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00057690-M14-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TNRC6C monoclonal antibody (M14), clone 3C4 now

Add to cart