TNRC6C monoclonal antibody (M08), clone 3G11 View larger

TNRC6C monoclonal antibody (M08), clone 3G11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TNRC6C monoclonal antibody (M08), clone 3G11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA

More info about TNRC6C monoclonal antibody (M08), clone 3G11

Brand: Abnova
Reference: H00057690-M08
Product name: TNRC6C monoclonal antibody (M08), clone 3G11
Product description: Mouse monoclonal antibody raised against a partial recombinant TNRC6C.
Clone: 3G11
Isotype: IgG2a Kappa
Gene id: 57690
Gene name: TNRC6C
Gene alias: FLJ20015|KIAA1582
Gene description: trinucleotide repeat containing 6C
Genbank accession: NM_018996
Immunogen: TNRC6C (NP_061869, 181 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TDGPNNTNPMNSSPNPINAMQTNGLPNWGMAVGMGAIIPPHLQGLPGANGSSVSQVSGGSAEGISNSVWGLSPGNPATGNSNSGFSQGNGDTVNSALSAK
Protein accession: NP_061869
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00057690-M08-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to TNRC6C on HeLa cell . [antibody concentration 10 ug/ml]
Applications: IF,ELISA
Shipping condition: Dry Ice

Reviews

Buy TNRC6C monoclonal antibody (M08), clone 3G11 now

Add to cart