Brand: | Abnova |
Reference: | H00057690-M08 |
Product name: | TNRC6C monoclonal antibody (M08), clone 3G11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TNRC6C. |
Clone: | 3G11 |
Isotype: | IgG2a Kappa |
Gene id: | 57690 |
Gene name: | TNRC6C |
Gene alias: | FLJ20015|KIAA1582 |
Gene description: | trinucleotide repeat containing 6C |
Genbank accession: | NM_018996 |
Immunogen: | TNRC6C (NP_061869, 181 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TDGPNNTNPMNSSPNPINAMQTNGLPNWGMAVGMGAIIPPHLQGLPGANGSSVSQVSGGSAEGISNSVWGLSPGNPATGNSNSGFSQGNGDTVNSALSAK |
Protein accession: | NP_061869 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to TNRC6C on HeLa cell . [antibody concentration 10 ug/ml] |
Applications: | IF,ELISA |
Shipping condition: | Dry Ice |