LRRC4C monoclonal antibody (M05), clone 1G5 View larger

LRRC4C monoclonal antibody (M05), clone 1G5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LRRC4C monoclonal antibody (M05), clone 1G5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about LRRC4C monoclonal antibody (M05), clone 1G5

Brand: Abnova
Reference: H00057689-M05
Product name: LRRC4C monoclonal antibody (M05), clone 1G5
Product description: Mouse monoclonal antibody raised against a partial recombinant LRRC4C.
Clone: 1G5
Isotype: IgG2a Kappa
Gene id: 57689
Gene name: LRRC4C
Gene alias: KIAA1580|NGL-1|NGL1
Gene description: leucine rich repeat containing 4C
Genbank accession: NM_020929
Immunogen: LRRC4C (NP_065980.1, 541 a.a. ~ 640 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AVMLVIFYKMRKQHHRQNHHAPTRTVEIINVDDEITGDTPMESHLPMPAIEHEHLNHYNSYKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKDNVQETQI
Protein accession: NP_065980.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00057689-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00057689-M05-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged LRRC4C is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy LRRC4C monoclonal antibody (M05), clone 1G5 now

Add to cart