Brand: | Abnova |
Reference: | H00057689-M05 |
Product name: | LRRC4C monoclonal antibody (M05), clone 1G5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant LRRC4C. |
Clone: | 1G5 |
Isotype: | IgG2a Kappa |
Gene id: | 57689 |
Gene name: | LRRC4C |
Gene alias: | KIAA1580|NGL-1|NGL1 |
Gene description: | leucine rich repeat containing 4C |
Genbank accession: | NM_020929 |
Immunogen: | LRRC4C (NP_065980.1, 541 a.a. ~ 640 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AVMLVIFYKMRKQHHRQNHHAPTRTVEIINVDDEITGDTPMESHLPMPAIEHEHLNHYNSYKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKDNVQETQI |
Protein accession: | NP_065980.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged LRRC4C is 0.1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |