Brand: | Abnova |
Reference: | H00057680-M11A |
Product name: | CHD8 monoclonal antibody (M11A), clone 2C8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CHD8. |
Clone: | 2C8 |
Isotype: | IgG2a Kappa |
Gene id: | 57680 |
Gene name: | CHD8 |
Gene alias: | DKFZp686N17164|HELSNF1|KIAA1564 |
Gene description: | chromodomain helicase DNA binding protein 8 |
Genbank accession: | NM_020920.3 |
Immunogen: | CHD8 (NP_065971.2, 1980 a.a. ~ 2078 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EGLKLTFQKHKLMANGVMGDGHPLFHKKKGNRKKLVELEVECMEEPNHLDVDLETRIPVINKVDGTLLVGEDAPRRAELEMWLQGHPEFAVDPRFLAYM |
Protein accession: | NP_065971.2 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |