CHD8 monoclonal antibody (M11A), clone 2C8 View larger

CHD8 monoclonal antibody (M11A), clone 2C8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CHD8 monoclonal antibody (M11A), clone 2C8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about CHD8 monoclonal antibody (M11A), clone 2C8

Brand: Abnova
Reference: H00057680-M11A
Product name: CHD8 monoclonal antibody (M11A), clone 2C8
Product description: Mouse monoclonal antibody raised against a partial recombinant CHD8.
Clone: 2C8
Isotype: IgG2a Kappa
Gene id: 57680
Gene name: CHD8
Gene alias: DKFZp686N17164|HELSNF1|KIAA1564
Gene description: chromodomain helicase DNA binding protein 8
Genbank accession: NM_020920.3
Immunogen: CHD8 (NP_065971.2, 1980 a.a. ~ 2078 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EGLKLTFQKHKLMANGVMGDGHPLFHKKKGNRKKLVELEVECMEEPNHLDVDLETRIPVINKVDGTLLVGEDAPRRAELEMWLQGHPEFAVDPRFLAYM
Protein accession: NP_065971.2
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00057680-M11A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CHD8 monoclonal antibody (M11A), clone 2C8 now

Add to cart