KIAA1510 monoclonal antibody (M01), clone 1F5 View larger

KIAA1510 monoclonal antibody (M01), clone 1F5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KIAA1510 monoclonal antibody (M01), clone 1F5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about KIAA1510 monoclonal antibody (M01), clone 1F5

Brand: Abnova
Reference: H00057642-M01
Product name: KIAA1510 monoclonal antibody (M01), clone 1F5
Product description: Mouse monoclonal antibody raised against a full length recombinant KIAA1510.
Clone: 1F5
Isotype: IgG1 kappa
Gene id: 57642
Gene name: COL20A1
Gene alias: KIAA1510|bA261N11.4
Gene description: collagen, type XX, alpha 1
Genbank accession: BC019637
Immunogen: KIAA1510 (AAH19637, 1 a.a. ~ 155 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MRGLEGTAGLPGPPGPRGFQGMAGARGTSGERGPPGTVGPTGLPGPKGERGEKGEPQSLATLYQLVSQACESAIQTHVSKFDSFHENTRPPMPILEQKLEPGTEPLGSPGTRSKALVPGEWGRGGRHLEGRGEPGAVGQMGSPGQQGASTQGLWE
Protein accession: AAH19637
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00057642-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged COL20A1 is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy KIAA1510 monoclonal antibody (M01), clone 1F5 now

Add to cart