Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00057634-M01 |
Product name: | EP400 monoclonal antibody (M01), clone 2A7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant EP400. |
Clone: | 2A7 |
Isotype: | IgG2a Kappa |
Gene id: | 57634 |
Gene name: | EP400 |
Gene alias: | CAGH32|DKFZP434I225|FLJ42018|FLJ45115|P400|TNRC12 |
Gene description: | E1A binding protein p400 |
Genbank accession: | NM_015409 |
Immunogen: | EP400 (NP_056224.2, 743 a.a. ~ 850 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QVHQRIAELRKAGLWSQRRLPKLQEAPRPKSHWDYLLEEMQWMATDFAQERRWKVAAAKKLVRTVVRHHEEKQLREERGKKEEQSRLRRIAASTAREIECFWSNIEQV |
Protein accession: | NP_056224.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of EP400 expression in transfected 293T cell line by EP400 monoclonal antibody (M01), clone 2A7. Lane 1: EP400 transfected lysate(105.7 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Hepatitis C Virus NS3 Protein Can Activate the Notch-Signaling Pathway through Binding to a Transcription Factor, SRCAP.Iwai A, Takegami T, Shiozaki T, Miyazaki T. PLoS One. 2011;6(6):e20718. Epub 2011 Jun 6. |