EP400 monoclonal antibody (M01), clone 2A7 View larger

EP400 monoclonal antibody (M01), clone 2A7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EP400 monoclonal antibody (M01), clone 2A7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about EP400 monoclonal antibody (M01), clone 2A7

Brand: Abnova
Reference: H00057634-M01
Product name: EP400 monoclonal antibody (M01), clone 2A7
Product description: Mouse monoclonal antibody raised against a partial recombinant EP400.
Clone: 2A7
Isotype: IgG2a Kappa
Gene id: 57634
Gene name: EP400
Gene alias: CAGH32|DKFZP434I225|FLJ42018|FLJ45115|P400|TNRC12
Gene description: E1A binding protein p400
Genbank accession: NM_015409
Immunogen: EP400 (NP_056224.2, 743 a.a. ~ 850 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QVHQRIAELRKAGLWSQRRLPKLQEAPRPKSHWDYLLEEMQWMATDFAQERRWKVAAAKKLVRTVVRHHEEKQLREERGKKEEQSRLRRIAASTAREIECFWSNIEQV
Protein accession: NP_056224.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00057634-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.62 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00057634-M01-13-15-1.jpg
Application image note: Western Blot analysis of EP400 expression in transfected 293T cell line by EP400 monoclonal antibody (M01), clone 2A7.

Lane 1: EP400 transfected lysate(105.7 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice
Publications: Hepatitis C Virus NS3 Protein Can Activate the Notch-Signaling Pathway through Binding to a Transcription Factor, SRCAP.Iwai A, Takegami T, Shiozaki T, Miyazaki T.
PLoS One. 2011;6(6):e20718. Epub 2011 Jun 6.

Reviews

Buy EP400 monoclonal antibody (M01), clone 2A7 now

Add to cart