SH3MD2 monoclonal antibody (M02), clone 1F7 View larger

SH3MD2 monoclonal antibody (M02), clone 1F7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SH3MD2 monoclonal antibody (M02), clone 1F7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about SH3MD2 monoclonal antibody (M02), clone 1F7

Brand: Abnova
Reference: H00057630-M02
Product name: SH3MD2 monoclonal antibody (M02), clone 1F7
Product description: Mouse monoclonal antibody raised against a partial recombinant SH3MD2.
Clone: 1F7
Isotype: IgG2a Kappa
Gene id: 57630
Gene name: SH3RF1
Gene alias: FLJ21602|KIAA1494|POSH|RNF142|SH3MD2
Gene description: SH3 domain containing ring finger 1
Genbank accession: NM_020870
Immunogen: SH3MD2 (NP_065921, 790 a.a. ~ 888 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LAQDAFHRKASSLDSAVPIAPPPRQACSSLGPVLNESRPVVCERHRVVVSYPPQSEAELELKEGDIVFVHKKREDGWFKGTLQRNGKTGLFPGSFVENI
Protein accession: NP_065921
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00057630-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00057630-M02-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged SH3RF1 is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SH3MD2 monoclonal antibody (M02), clone 1F7 now

Add to cart