SH3MD2 monoclonal antibody (M01), clone 3H3 View larger

SH3MD2 monoclonal antibody (M01), clone 3H3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SH3MD2 monoclonal antibody (M01), clone 3H3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about SH3MD2 monoclonal antibody (M01), clone 3H3

Brand: Abnova
Reference: H00057630-M01
Product name: SH3MD2 monoclonal antibody (M01), clone 3H3
Product description: Mouse monoclonal antibody raised against a partial recombinant SH3MD2.
Clone: 3H3
Isotype: IgG2a Kappa
Gene id: 57630
Gene name: SH3RF1
Gene alias: FLJ21602|KIAA1494|POSH|RNF142|SH3MD2
Gene description: SH3 domain containing ring finger 1
Genbank accession: NM_020870
Immunogen: SH3MD2 (NP_065921, 790 a.a. ~ 888 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LAQDAFHRKASSLDSAVPIAPPPRQACSSLGPVLNESRPVVCERHRVVVSYPPQSEAELELKEGDIVFVHKKREDGWFKGTLQRNGKTGLFPGSFVENI
Protein accession: NP_065921
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00057630-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00057630-M01-1-1-1.jpg
Application image note: SH3MD2 monoclonal antibody (M01), clone 3H3 Western Blot analysis of SH3MD2 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Sh3rf2/POSHER promotes cell survival by RING-mediated proteasomal degradation of the JNK scaffold POSH.Wilhelm M, Kukekov NV, Schmit TL, Biagas KV, Sproul AA, Gire S, Maes ME, Xu Z, Greene LA.
J Biol Chem. 2011 Nov 28.

Reviews

Buy SH3MD2 monoclonal antibody (M01), clone 3H3 now

Add to cart