Brand: | Abnova |
Reference: | H00057617-M02A |
Product name: | VPS18 monoclonal antibody (M02A), clone 2G10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant VPS18. |
Clone: | 2G10 |
Isotype: | IgG2a Kappa |
Gene id: | 57617 |
Gene name: | VPS18 |
Gene alias: | KIAA1475|PEP3 |
Gene description: | vacuolar protein sorting 18 homolog (S. cerevisiae) |
Genbank accession: | NM_020857 |
Immunogen: | VPS18 (NP_065908, 3 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SILDEYENSLSRSAVLQPGCPSVGIPHSGYVNAQLEKEVPIFTKQRIDFTPSERITSLVVSSNQLCMSLGKDTLLRIDLGKANEPNHVELGRKDDAKV |
Protein accession: | NP_065908 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: |  |
Application image note: | VPS18 monoclonal antibody (M02A), clone 2G10. Western Blot analysis of VPS18 expression in Raw 264.7. |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |