VPS18 monoclonal antibody (M02A), clone 2G10 View larger

VPS18 monoclonal antibody (M02A), clone 2G10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of VPS18 monoclonal antibody (M02A), clone 2G10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about VPS18 monoclonal antibody (M02A), clone 2G10

Brand: Abnova
Reference: H00057617-M02A
Product name: VPS18 monoclonal antibody (M02A), clone 2G10
Product description: Mouse monoclonal antibody raised against a partial recombinant VPS18.
Clone: 2G10
Isotype: IgG2a Kappa
Gene id: 57617
Gene name: VPS18
Gene alias: KIAA1475|PEP3
Gene description: vacuolar protein sorting 18 homolog (S. cerevisiae)
Genbank accession: NM_020857
Immunogen: VPS18 (NP_065908, 3 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SILDEYENSLSRSAVLQPGCPSVGIPHSGYVNAQLEKEVPIFTKQRIDFTPSERITSLVVSSNQLCMSLGKDTLLRIDLGKANEPNHVELGRKDDAKV
Protein accession: NP_065908
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00057617-M02A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00057617-M02A-1-27-1.jpg
Application image note: VPS18 monoclonal antibody (M02A), clone 2G10. Western Blot analysis of VPS18 expression in Raw 264.7.
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy VPS18 monoclonal antibody (M02A), clone 2G10 now

Add to cart