EBF4 monoclonal antibody (M04), clone 4E10 View larger

EBF4 monoclonal antibody (M04), clone 4E10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EBF4 monoclonal antibody (M04), clone 4E10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about EBF4 monoclonal antibody (M04), clone 4E10

Brand: Abnova
Reference: H00057593-M04
Product name: EBF4 monoclonal antibody (M04), clone 4E10
Product description: Mouse monoclonal antibody raised against a full-length recombinant EBF4.
Clone: 4E10
Isotype: IgG2a Kappa
Gene id: 57593
Gene name: EBF4
Gene alias: COE4|KIAA1442|O/E-4
Gene description: early B-cell factor 4
Genbank accession: BC054347.1
Immunogen: EBF4 (AAH54347.1, 1 a.a. ~ 88 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MPSSPPLAAASSMSLPAAAPTTSVFSFSPVNMISAVKQRSAFAPVLRPPSSPPQACPRAHGEGLPDQSFEDSDKFHSPARGLQGLAYS
Protein accession: AAH54347.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00057593-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.5 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00057593-M04-13-15-1.jpg
Application image note: Western Blot analysis of EBF4 expression in transfected 293T cell line by EBF4 monoclonal antibody (M04), clone 4E10.

Lane 1: EBF4 transfected lysate (Predicted MW: 9.1 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy EBF4 monoclonal antibody (M04), clone 4E10 now

Add to cart