PCDH10 monoclonal antibody (M07), clone 2H6 View larger

PCDH10 monoclonal antibody (M07), clone 2H6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PCDH10 monoclonal antibody (M07), clone 2H6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr

More info about PCDH10 monoclonal antibody (M07), clone 2H6

Brand: Abnova
Reference: H00057575-M07
Product name: PCDH10 monoclonal antibody (M07), clone 2H6
Product description: Mouse monoclonal antibody raised against a partial recombinant PCDH10.
Clone: 2H6
Isotype: IgG2b Kappa
Gene id: 57575
Gene name: PCDH10
Gene alias: DKFZp761O2023|KIAA1400|MGC133344|OL-PCDH|PCDH19
Gene description: protocadherin 10
Genbank accession: NM_020815
Immunogen: PCDH10 (NP_065866, 18 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SQLHYTVQEEQEHGTFVGNIAEDLGLDITKLSARGFQTVPNSRTPYLDLNLETGVLYVNEKIDREQICKQSPSCVLHLEVFLENPLELFQVEIEVLDINDNPPSFPEPDL
Protein accession: NP_065866
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00057575-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00057575-M07-1-12-1.jpg
Application image note: PCDH10 monoclonal antibody (M07), clone 2H6. Western Blot analysis of PCDH10 expression in HepG2 ( Cat # L019V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PCDH10 monoclonal antibody (M07), clone 2H6 now

Add to cart