Brand: | Abnova |
Reference: | H00057575-M07 |
Product name: | PCDH10 monoclonal antibody (M07), clone 2H6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PCDH10. |
Clone: | 2H6 |
Isotype: | IgG2b Kappa |
Gene id: | 57575 |
Gene name: | PCDH10 |
Gene alias: | DKFZp761O2023|KIAA1400|MGC133344|OL-PCDH|PCDH19 |
Gene description: | protocadherin 10 |
Genbank accession: | NM_020815 |
Immunogen: | PCDH10 (NP_065866, 18 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SQLHYTVQEEQEHGTFVGNIAEDLGLDITKLSARGFQTVPNSRTPYLDLNLETGVLYVNEKIDREQICKQSPSCVLHLEVFLENPLELFQVEIEVLDINDNPPSFPEPDL |
Protein accession: | NP_065866 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | PCDH10 monoclonal antibody (M07), clone 2H6. Western Blot analysis of PCDH10 expression in HepG2 ( Cat # L019V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |