Brand: | Abnova |
Reference: | H00057556-M05 |
Product name: | SEMA6A monoclonal antibody (M05), clone 1C8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SEMA6A. |
Clone: | 1C8 |
Isotype: | IgG2a Kappa |
Gene id: | 57556 |
Gene name: | SEMA6A |
Gene alias: | HT018|KIAA1368|SEMA|SEMA6A1|SEMAQ|VIA |
Gene description: | sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6A |
Genbank accession: | NM_020796 |
Immunogen: | SEMA6A (NP_065847, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PEDSEPISISHGNYTKQYPVFVGHKPGRNTTQRHRLDIQMIMIMNGTLYIAARDHIYTVDIDTSHTEEIYCSKKLTWKSRQADVDTCRMKGKHKDECHNF |
Protein accession: | NP_065847 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged SEMA6A is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |