SEMA6A monoclonal antibody (M05), clone 1C8 View larger

SEMA6A monoclonal antibody (M05), clone 1C8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SEMA6A monoclonal antibody (M05), clone 1C8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about SEMA6A monoclonal antibody (M05), clone 1C8

Brand: Abnova
Reference: H00057556-M05
Product name: SEMA6A monoclonal antibody (M05), clone 1C8
Product description: Mouse monoclonal antibody raised against a partial recombinant SEMA6A.
Clone: 1C8
Isotype: IgG2a Kappa
Gene id: 57556
Gene name: SEMA6A
Gene alias: HT018|KIAA1368|SEMA|SEMA6A1|SEMAQ|VIA
Gene description: sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6A
Genbank accession: NM_020796
Immunogen: SEMA6A (NP_065847, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PEDSEPISISHGNYTKQYPVFVGHKPGRNTTQRHRLDIQMIMIMNGTLYIAARDHIYTVDIDTSHTEEIYCSKKLTWKSRQADVDTCRMKGKHKDECHNF
Protein accession: NP_065847
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00057556-M05-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged SEMA6A is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy SEMA6A monoclonal antibody (M05), clone 1C8 now

Add to cart