Brand: | Abnova |
Reference: | H00057553-M08 |
Product name: | MICAL3 monoclonal antibody (M08), clone 3A6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MICAL3. |
Clone: | 3A6 |
Isotype: | IgG2a Kappa |
Gene id: | 57553 |
Gene name: | MICAL3 |
Gene alias: | KIAA0819|MGC189703 |
Gene description: | microtubule associated monoxygenase, calponin and LIM domain containing 3 |
Genbank accession: | XM_032996 |
Immunogen: | MICAL3 (XP_032996.2, 251 a.a. ~ 340 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DDQHWSDSPSDADRELRLPCPAEGEAELELRVSEDEEKLPASPKHQERGPSQATSPIRSPQESALLFIPVHSPSTEGPQLPPVPAATQEK |
Protein accession: | XP_032996.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged MICAL3 is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |