MICAL3 monoclonal antibody (M08), clone 3A6 View larger

MICAL3 monoclonal antibody (M08), clone 3A6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MICAL3 monoclonal antibody (M08), clone 3A6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about MICAL3 monoclonal antibody (M08), clone 3A6

Brand: Abnova
Reference: H00057553-M08
Product name: MICAL3 monoclonal antibody (M08), clone 3A6
Product description: Mouse monoclonal antibody raised against a partial recombinant MICAL3.
Clone: 3A6
Isotype: IgG2a Kappa
Gene id: 57553
Gene name: MICAL3
Gene alias: KIAA0819|MGC189703
Gene description: microtubule associated monoxygenase, calponin and LIM domain containing 3
Genbank accession: XM_032996
Immunogen: MICAL3 (XP_032996.2, 251 a.a. ~ 340 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DDQHWSDSPSDADRELRLPCPAEGEAELELRVSEDEEKLPASPKHQERGPSQATSPIRSPQESALLFIPVHSPSTEGPQLPPVPAATQEK
Protein accession: XP_032996.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00057553-M08-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.64 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00057553-M08-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged MICAL3 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MICAL3 monoclonal antibody (M08), clone 3A6 now

Add to cart