TAOK1 monoclonal antibody (M01), clone 4E12 View larger

TAOK1 monoclonal antibody (M01), clone 4E12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TAOK1 monoclonal antibody (M01), clone 4E12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re

More info about TAOK1 monoclonal antibody (M01), clone 4E12

Brand: Abnova
Reference: H00057551-M01
Product name: TAOK1 monoclonal antibody (M01), clone 4E12
Product description: Mouse monoclonal antibody raised against a partial recombinant TAOK1.
Clone: 4E12
Isotype: IgG3 Kappa
Gene id: 57551
Gene name: TAOK1
Gene alias: FLJ14314|KIAA1361|MAP3K16|MARKK|PSK2|TAO1
Gene description: TAO kinase 1
Genbank accession: NM_020791
Immunogen: TAOK1 (NP_065842, 892 a.a. ~ 1001 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LSNLSPEAFSHSYPGASGWSHNPTGGPGPHWGHPMGGPPQAWGHPMQGGPQPWGHPSGPMQGVPRGSSMGVRNSPQALRRTASGGRTEQGMSRSTSVTSQISNGSHMSYT
Protein accession: NP_065842
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00057551-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00057551-M01-1-1-1.jpg
Application image note: TAOK1 monoclonal antibody (M01), clone 4E12 Western Blot analysis of TAOK1 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TAOK1 monoclonal antibody (M01), clone 4E12 now

Add to cart