Brand: | Abnova |
Reference: | H00057551-M01 |
Product name: | TAOK1 monoclonal antibody (M01), clone 4E12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TAOK1. |
Clone: | 4E12 |
Isotype: | IgG3 Kappa |
Gene id: | 57551 |
Gene name: | TAOK1 |
Gene alias: | FLJ14314|KIAA1361|MAP3K16|MARKK|PSK2|TAO1 |
Gene description: | TAO kinase 1 |
Genbank accession: | NM_020791 |
Immunogen: | TAOK1 (NP_065842, 892 a.a. ~ 1001 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LSNLSPEAFSHSYPGASGWSHNPTGGPGPHWGHPMGGPPQAWGHPMQGGPQPWGHPSGPMQGVPRGSSMGVRNSPQALRRTASGGRTEQGMSRSTSVTSQISNGSHMSYT |
Protein accession: | NP_065842 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | TAOK1 monoclonal antibody (M01), clone 4E12 Western Blot analysis of TAOK1 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |