SORCS2 monoclonal antibody (M03), clone 1D7 View larger

SORCS2 monoclonal antibody (M03), clone 1D7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SORCS2 monoclonal antibody (M03), clone 1D7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA

More info about SORCS2 monoclonal antibody (M03), clone 1D7

Brand: Abnova
Reference: H00057537-M03
Product name: SORCS2 monoclonal antibody (M03), clone 1D7
Product description: Mouse monoclonal antibody raised against a partial recombinant SORCS2.
Clone: 1D7
Isotype: IgG2a Kappa
Gene id: 57537
Gene name: SORCS2
Gene alias: -
Gene description: sortilin-related VPS10 domain containing receptor 2
Genbank accession: NM_020777.1
Immunogen: SORCS2 (NP_065828.1, 802 a.a. ~ 900 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VLRVLDQFQVMPLQFSKELDAYNPNTPEWREDVGLVVTRLLSKETSVPQELLVTVVKPGLPTLADLYVLLPPPRPTRKRSLSSDKRLAAIQQVLNAQKI
Protein accession: NP_065828.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00057537-M03-1-12-1.jpg
Application image note: SORCS2 monoclonal antibody (M03), clone 1D7. Western Blot analysis of SORCS2 expression in HepG2(Cat # L019V1 ).
Applications: WB-Ce,S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy SORCS2 monoclonal antibody (M03), clone 1D7 now

Add to cart