Brand: | Abnova |
Reference: | H00057534-M03 |
Product name: | MIB1 monoclonal antibody (M03), clone 2A9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MIB1. |
Clone: | 2A9 |
Isotype: | IgG2a Kappa |
Gene id: | 57534 |
Gene name: | MIB1 |
Gene alias: | DIP-1|DKFZp686I0769|DKFZp761M1710|FLJ90676|MGC129659|MGC129660|MIB|ZZANK2|ZZZ6 |
Gene description: | mindbomb homolog 1 (Drosophila) |
Genbank accession: | NM_020774 |
Immunogen: | MIB1 (NP_065825, 909 a.a. ~ 1006 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PFIMCCGGKSSEDATDDISSGNIPVLQKDKDNTNVNADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIERRILLY |
Protein accession: | NP_065825 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged MIB1 is approximately 0.1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |