MIB1 monoclonal antibody (M02), clone 3E10 View larger

MIB1 monoclonal antibody (M02), clone 3E10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MIB1 monoclonal antibody (M02), clone 3E10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about MIB1 monoclonal antibody (M02), clone 3E10

Brand: Abnova
Reference: H00057534-M02
Product name: MIB1 monoclonal antibody (M02), clone 3E10
Product description: Mouse monoclonal antibody raised against a partial recombinant MIB1.
Clone: 3E10
Isotype: IgG2a Kappa
Gene id: 57534
Gene name: MIB1
Gene alias: DIP-1|DKFZp686I0769|DKFZp761M1710|FLJ90676|MGC129659|MGC129660|MIB|ZZANK2|ZZZ6
Gene description: mindbomb homolog 1 (Drosophila)
Genbank accession: NM_020774
Immunogen: MIB1 (NP_065825, 909 a.a. ~ 1006 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PFIMCCGGKSSEDATDDISSGNIPVLQKDKDNTNVNADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIERRILLY
Protein accession: NP_065825
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00057534-M02-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged MIB1 is 3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy MIB1 monoclonal antibody (M02), clone 3E10 now

Add to cart