HACE1 monoclonal antibody (M04), clone 2B3 View larger

HACE1 monoclonal antibody (M04), clone 2B3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HACE1 monoclonal antibody (M04), clone 2B3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about HACE1 monoclonal antibody (M04), clone 2B3

Brand: Abnova
Reference: H00057531-M04
Product name: HACE1 monoclonal antibody (M04), clone 2B3
Product description: Mouse monoclonal antibody raised against a partial recombinant HACE1.
Clone: 2B3
Isotype: IgG2a Kappa
Gene id: 57531
Gene name: HACE1
Gene alias: -
Gene description: HECT domain and ankyrin repeat containing, E3 ubiquitin protein ligase 1
Genbank accession: NM_020771
Immunogen: HACE1 (NP_065822, 800 a.a. ~ 909 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TEYTSGYEREDPVIQWFWEVVEDITQEERVLLLQFVTGSSRVPHGGFANIMGGSGLQNFTIAAVPYTPNLLPTSSTCINMLKLPEYPSKEILKDRLLVALHCGSYGYTMA
Protein accession: NP_065822
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy HACE1 monoclonal antibody (M04), clone 2B3 now

Add to cart