PCDH19 monoclonal antibody (M04), clone 2G10 View larger

PCDH19 monoclonal antibody (M04), clone 2G10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PCDH19 monoclonal antibody (M04), clone 2G10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about PCDH19 monoclonal antibody (M04), clone 2G10

Brand: Abnova
Reference: H00057526-M04
Product name: PCDH19 monoclonal antibody (M04), clone 2G10
Product description: Mouse monoclonal antibody raised against a partial recombinant PCDH19.
Clone: 2G10
Isotype: IgG2a Kappa
Gene id: 57526
Gene name: PCDH19
Gene alias: DKFZp686P1843|EFMR|KIAA1313
Gene description: protocadherin 19
Genbank accession: NM_020766
Immunogen: PCDH19 (NP_065817, 241 a.a. ~ 340 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RLVPRDVEETDKMNVVSCSSLTSSLNYFDYHQQTLPLGCRRSESTFLNVENQNTRNTSANHIYHHSFNSQGPQQPDLIINGAPLPETENYSFDSNYVNSR
Protein accession: NP_065817
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00057526-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PCDH19 monoclonal antibody (M04), clone 2G10 now

Add to cart