Brand: | Abnova |
Reference: | H00057520-M02 |
Product name: | HECW2 monoclonal antibody (M02), clone 1A3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HECW2. |
Clone: | 1A3 |
Isotype: | IgG2b Kappa |
Gene id: | 57520 |
Gene name: | HECW2 |
Gene alias: | DKFZp686M17164|NEDL2 |
Gene description: | HECT, C2 and WW domain containing E3 ubiquitin protein ligase 2 |
Genbank accession: | NM_020760 |
Immunogen: | HECW2 (NP_065811, 637 a.a. ~ 745 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DLECADSSCNESVTTQLSSVDTRCSSLESARFPETPAFSSQEEEDGACAAEPTSSGPAEGSQESVCTAGSLPVVQVPSGEDEGPGAESATVPDQEELGEVWQRRGSLEG |
Protein accession: | NP_065811 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |