HECW2 monoclonal antibody (M01), clone 5H1 View larger

HECW2 monoclonal antibody (M01), clone 5H1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HECW2 monoclonal antibody (M01), clone 5H1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about HECW2 monoclonal antibody (M01), clone 5H1

Brand: Abnova
Reference: H00057520-M01
Product name: HECW2 monoclonal antibody (M01), clone 5H1
Product description: Mouse monoclonal antibody raised against a partial recombinant HECW2.
Clone: 5H1
Isotype: IgG2b Kappa
Gene id: 57520
Gene name: HECW2
Gene alias: DKFZp686M17164|NEDL2
Gene description: HECT, C2 and WW domain containing E3 ubiquitin protein ligase 2
Genbank accession: NM_020760
Immunogen: HECW2 (NP_065811, 637 a.a. ~ 745 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DLECADSSCNESVTTQLSSVDTRCSSLESARFPETPAFSSQEEEDGACAAEPTSSGPAEGSQESVCTAGSLPVVQVPSGEDEGPGAESATVPDQEELGEVWQRRGSLEG
Protein accession: NP_065811
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00057520-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00057520-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged HECW2 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HECW2 monoclonal antibody (M01), clone 5H1 now

Add to cart