Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of COG6 monoclonal antibody (M01), clone 5B5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about COG6 monoclonal antibody (M01), clone 5B5
| Brand: | Abnova |
| Reference: | H00057511-M01 |
| Product name: | COG6 monoclonal antibody (M01), clone 5B5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant COG6. |
| Clone: | 5B5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 57511 |
| Gene name: | COG6 |
| Gene alias: | COD2|DKFZp313D191|KIAA1134 |
| Gene description: | component of oligomeric golgi complex 6 |
| Genbank accession: | NM_020751 |
| Immunogen: | COG6 (NP_065802, 558 a.a. ~ 657 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QQHKPEQGSLANMPNLDSVTLKAAMVQFDRYLSAPDNLLIPQLNFLLSATVKEQIVKQSTELVCRAYGEVYAAVMNPINEYKDPENILHRSPQQVQTLLS |
| Protein accession: | NP_065802 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | COG6 monoclonal antibody (M01), clone 5B5 Western Blot analysis of COG6 expression in A-431 ( Cat # L015V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | A genome-wide association study of psoriasis and psoriatic arthritis identifies new disease Loci.Liu Y, Helms C, Liao W, Zaba LC, Duan S, Gardner J, Wise C, Miner A, Malloy MJ, Pullinger CR, Kane JP, Saccone S, Worthington J, Bruce I, Kwok PY, Menter A, Krueger J, Barton A, Saccone NL, Bowcock AM. PLoS Genet. 2008 Mar 28;4(3):e1000041. |