MTA3 monoclonal antibody (M06), clone 2C5 View larger

MTA3 monoclonal antibody (M06), clone 2C5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MTA3 monoclonal antibody (M06), clone 2C5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA

More info about MTA3 monoclonal antibody (M06), clone 2C5

Brand: Abnova
Reference: H00057504-M06
Product name: MTA3 monoclonal antibody (M06), clone 2C5
Product description: Mouse monoclonal antibody raised against a partial recombinant MTA3.
Clone: 2C5
Isotype: IgG2b Kappa
Gene id: 57504
Gene name: MTA3
Gene alias: KIAA1266
Gene description: metastasis associated 1 family, member 3
Genbank accession: NM_020744
Immunogen: MTA3 (NP_065795, 416 a.a. ~ 515 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LKMPTQSEEEKLSPSPTTEDPRVRSHVSRQAMQGMPVRNTGSPKSAVKTRQAFFLHTTYFTKFARQVCKNTLRLRQAARRPFVAINYAAIRAECKMLLNS
Protein accession: NP_065795
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00057504-M06-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to MTA3 on HeLa cell . [antibody concentration 10 ug/ml]
Applications: IF,ELISA
Shipping condition: Dry Ice

Reviews

Buy MTA3 monoclonal antibody (M06), clone 2C5 now

Add to cart