Brand: | Abnova |
Reference: | H00057504-M06 |
Product name: | MTA3 monoclonal antibody (M06), clone 2C5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MTA3. |
Clone: | 2C5 |
Isotype: | IgG2b Kappa |
Gene id: | 57504 |
Gene name: | MTA3 |
Gene alias: | KIAA1266 |
Gene description: | metastasis associated 1 family, member 3 |
Genbank accession: | NM_020744 |
Immunogen: | MTA3 (NP_065795, 416 a.a. ~ 515 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LKMPTQSEEEKLSPSPTTEDPRVRSHVSRQAMQGMPVRNTGSPKSAVKTRQAFFLHTTYFTKFARQVCKNTLRLRQAARRPFVAINYAAIRAECKMLLNS |
Protein accession: | NP_065795 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to MTA3 on HeLa cell . [antibody concentration 10 ug/ml] |
Applications: | IF,ELISA |
Shipping condition: | Dry Ice |