ARID1B monoclonal antibody (M01), clone 2D2 View larger

ARID1B monoclonal antibody (M01), clone 2D2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ARID1B monoclonal antibody (M01), clone 2D2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re

More info about ARID1B monoclonal antibody (M01), clone 2D2

Brand: Abnova
Reference: H00057492-M01
Product name: ARID1B monoclonal antibody (M01), clone 2D2
Product description: Mouse monoclonal antibody raised against a partial recombinant ARID1B.
Clone: 2D2
Isotype: IgG2b Kappa
Gene id: 57492
Gene name: ARID1B
Gene alias: 6A3-5|BAF250b|BRIGHT|DAN15|ELD/OSA1|KIAA1235|p250R
Gene description: AT rich interactive domain 1B (SWI1-like)
Genbank accession: NM_017519
Immunogen: ARID1B (NP_059989, 1364 a.a. ~ 1460 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PPAKRHEGDMYNMQYSSQQQEMYNQYGGSYSGPDRRPIQGQYPYPYSRERMQGPGQIQTHGIPPQMMGGPLQSSSSEGPQQNMWAARNDMPYPYQNR
Protein accession: NP_059989
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00057492-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.41 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00057492-M01-3-2-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to ARID1B on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Frequent loss of the expression of multiple subunits of the SWI/SNF complex in large cell carcinoma and pleomorphic carcinoma of the lung.Yoshimoto T, Matsubara D1, Nakano T, Tamura T, Endo S, Sugiyama Y, Niki T.
Pathol Int. 2015 Sep 8. [Epub ahead of print]

Reviews

Buy ARID1B monoclonal antibody (M01), clone 2D2 now

Add to cart