Brand: | Abnova |
Reference: | H00057491-M01 |
Product name: | AHRR monoclonal antibody (M01), clone 5G11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant AHRR. |
Clone: | 5G11 |
Isotype: | IgG2a Kappa |
Gene id: | 57491 |
Gene name: | AHRR |
Gene alias: | AHH|AHHR|KIAA1234|MGC167813|MGC176630|bHLHe77 |
Gene description: | aryl-hydrocarbon receptor repressor |
Genbank accession: | NM_020731 |
Immunogen: | AHRR (NP_065782, 617 a.a. ~ 715 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RATAGRSRELTPFHPAHCACLEPTDGLPQSEPPHQLCARGRGEQSCTCRAAEAAPVVKREPLDSPQWATHSQGMVPGMLPKSALATLVPPQASGCTFLP |
Protein accession: | NP_065782 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | AHRR monoclonal antibody (M01), clone 5G11. Western Blot analysis of AHRR expression in A-431. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |