AHRR monoclonal antibody (M01), clone 5G11 View larger

AHRR monoclonal antibody (M01), clone 5G11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AHRR monoclonal antibody (M01), clone 5G11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about AHRR monoclonal antibody (M01), clone 5G11

Brand: Abnova
Reference: H00057491-M01
Product name: AHRR monoclonal antibody (M01), clone 5G11
Product description: Mouse monoclonal antibody raised against a partial recombinant AHRR.
Clone: 5G11
Isotype: IgG2a Kappa
Gene id: 57491
Gene name: AHRR
Gene alias: AHH|AHHR|KIAA1234|MGC167813|MGC176630|bHLHe77
Gene description: aryl-hydrocarbon receptor repressor
Genbank accession: NM_020731
Immunogen: AHRR (NP_065782, 617 a.a. ~ 715 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RATAGRSRELTPFHPAHCACLEPTDGLPQSEPPHQLCARGRGEQSCTCRAAEAAPVVKREPLDSPQWATHSQGMVPGMLPKSALATLVPPQASGCTFLP
Protein accession: NP_065782
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00057491-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00057491-M01-1-4-1.jpg
Application image note: AHRR monoclonal antibody (M01), clone 5G11. Western Blot analysis of AHRR expression in A-431.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy AHRR monoclonal antibody (M01), clone 5G11 now

Add to cart