RNF150 monoclonal antibody (M01), clone 5D11 View larger

RNF150 monoclonal antibody (M01), clone 5D11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RNF150 monoclonal antibody (M01), clone 5D11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about RNF150 monoclonal antibody (M01), clone 5D11

Brand: Abnova
Reference: H00057484-M01
Product name: RNF150 monoclonal antibody (M01), clone 5D11
Product description: Mouse monoclonal antibody raised against a partial recombinant RNF150.
Clone: 5D11
Isotype: IgG2a Kappa
Gene id: 57484
Gene name: RNF150
Gene alias: MGC125502
Gene description: ring finger protein 150
Genbank accession: NM_020724
Immunogen: RNF150 (NP_065775, 67 a.a. ~ 176 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LHTEKTECGRYGEHSPKQDARGEVVMASSAHDRLACDPNTKFAAPTRGKNWIALIPKGNCTYRDKIRNAFLQNASAVVIFNVGSNTNETITMPHAGVEDIVAIMIPEPKG
Protein accession: NP_065775
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00057484-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00057484-M01-13-15-1.jpg
Application image note: Western Blot analysis of RNF150 expression in transfected 293T cell line by RNF150 monoclonal antibody (M01), clone 5D11.

Lane 1: RNF150 transfected lysate(34.9 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RNF150 monoclonal antibody (M01), clone 5D11 now

Add to cart