Brand: | Abnova |
Reference: | H00057478-M01 |
Product name: | USP31 monoclonal antibody (M01), clone 3B6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant USP31. |
Clone: | 3B6 |
Isotype: | IgG2a Kappa |
Gene id: | 57478 |
Gene name: | USP31 |
Gene alias: | KIAA1203 |
Gene description: | ubiquitin specific peptidase 31 |
Genbank accession: | NM_020718 |
Immunogen: | USP31 (NP_065769, 1254 a.a. ~ 1352 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AGGSSVKSVCKNTGDDEAERGHQPPASQQPNANTTGKEQLVTKDPASAKHSLLSARKSKSSQLDSGVPSSPGGRQSAEKSSKKLSSSMQTSARPSQKPQ |
Protein accession: | NP_065769 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | USP31 monoclonal antibody (M01), clone 3B6 Western Blot analysis of USP31 expression in A-431( Cat # L015V1 ). |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |