USP31 monoclonal antibody (M01), clone 3B6 View larger

USP31 monoclonal antibody (M01), clone 3B6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of USP31 monoclonal antibody (M01), clone 3B6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about USP31 monoclonal antibody (M01), clone 3B6

Brand: Abnova
Reference: H00057478-M01
Product name: USP31 monoclonal antibody (M01), clone 3B6
Product description: Mouse monoclonal antibody raised against a partial recombinant USP31.
Clone: 3B6
Isotype: IgG2a Kappa
Gene id: 57478
Gene name: USP31
Gene alias: KIAA1203
Gene description: ubiquitin specific peptidase 31
Genbank accession: NM_020718
Immunogen: USP31 (NP_065769, 1254 a.a. ~ 1352 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AGGSSVKSVCKNTGDDEAERGHQPPASQQPNANTTGKEQLVTKDPASAKHSLLSARKSKSSQLDSGVPSSPGGRQSAEKSSKKLSSSMQTSARPSQKPQ
Protein accession: NP_065769
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00057478-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00057478-M01-1-4-1.jpg
Application image note: USP31 monoclonal antibody (M01), clone 3B6 Western Blot analysis of USP31 expression in A-431( Cat # L015V1 ).
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy USP31 monoclonal antibody (M01), clone 3B6 now

Add to cart