CNOT6 monoclonal antibody (M01), clone 4A3 View larger

CNOT6 monoclonal antibody (M01), clone 4A3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CNOT6 monoclonal antibody (M01), clone 4A3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about CNOT6 monoclonal antibody (M01), clone 4A3

Brand: Abnova
Reference: H00057472-M01
Product name: CNOT6 monoclonal antibody (M01), clone 4A3
Product description: Mouse monoclonal antibody raised against a partial recombinant CNOT6.
Clone: 4A3
Isotype: IgG2b Kappa
Gene id: 57472
Gene name: CNOT6
Gene alias: CCR4|KIAA1194
Gene description: CCR4-NOT transcription complex, subunit 6
Genbank accession: NM_015455
Immunogen: CNOT6 (NP_056270.2, 112 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LPFELGKLFQLQTLGLKGNPLTQDILNLYQEPDGTRRLLNYLLDNLSGTAKRITTEQPPPRSWIMLQEPDRTRPTALFSVMCYNVLCDKYATRQLYGYC
Protein accession: NP_056270.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy CNOT6 monoclonal antibody (M01), clone 4A3 now

Add to cart