Brand: | Abnova |
Reference: | H00057472-M01 |
Product name: | CNOT6 monoclonal antibody (M01), clone 4A3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CNOT6. |
Clone: | 4A3 |
Isotype: | IgG2b Kappa |
Gene id: | 57472 |
Gene name: | CNOT6 |
Gene alias: | CCR4|KIAA1194 |
Gene description: | CCR4-NOT transcription complex, subunit 6 |
Genbank accession: | NM_015455 |
Immunogen: | CNOT6 (NP_056270.2, 112 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LPFELGKLFQLQTLGLKGNPLTQDILNLYQEPDGTRRLLNYLLDNLSGTAKRITTEQPPPRSWIMLQEPDRTRPTALFSVMCYNVLCDKYATRQLYGYC |
Protein accession: | NP_056270.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |