HHATL monoclonal antibody (M07A), clone 2B7 View larger

HHATL monoclonal antibody (M07A), clone 2B7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HHATL monoclonal antibody (M07A), clone 2B7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about HHATL monoclonal antibody (M07A), clone 2B7

Brand: Abnova
Reference: H00057467-M07A
Product name: HHATL monoclonal antibody (M07A), clone 2B7
Product description: Mouse monoclonal antibody raised against a partial recombinant HHATL.
Clone: 2B7
Isotype: IgG1 Kappa
Gene id: 57467
Gene name: HHATL
Gene alias: C3orf3|GUP1|KIAA1173|MBOAT3|MSTP002|OACT3
Gene description: hedgehog acyltransferase-like
Genbank accession: NM_020707
Immunogen: HHATL (NP_065758.2, 157 a.a. ~ 206 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LISWQSGFVTGTFDLQEVLFHGGSSFTVLRCTSFALESCAHPDRHYSLAD
Protein accession: NP_065758.2
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy HHATL monoclonal antibody (M07A), clone 2B7 now

Add to cart