Brand: | Abnova |
Reference: | H00057459-M01 |
Product name: | GATAD2B monoclonal antibody (M01), clone 4G10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GATAD2B. |
Clone: | 4G10 |
Isotype: | IgG2a Kappa |
Gene id: | 57459 |
Gene name: | GATAD2B |
Gene alias: | FLJ37346|KIAA1150|MGC138257|MGC138285|P66beta|RP11-216N14.6 |
Gene description: | GATA zinc finger domain containing 2B |
Genbank accession: | NM_020699 |
Immunogen: | GATAD2B (NP_065750, 3 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RMTEDALRLNLLKRSLDPADERDDVLAKRLKMEGHEAMERLKMLALLKRKDLANLEVPHELPTKQDGSGVKGYEEKLNGNLRPHGDNRTAGRPGKENINDEPVDMSAR |
Protein accession: | NP_065750 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | GATAD2B monoclonal antibody (M01), clone 4G10 Western Blot analysis of GATAD2B expression in Jurkat ( Cat # L017V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |