KIAA1143 monoclonal antibody (M07), clone 4E11 View larger

KIAA1143 monoclonal antibody (M07), clone 4E11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KIAA1143 monoclonal antibody (M07), clone 4E11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about KIAA1143 monoclonal antibody (M07), clone 4E11

Brand: Abnova
Reference: H00057456-M07
Product name: KIAA1143 monoclonal antibody (M07), clone 4E11
Product description: Mouse monoclonal antibody raised against a full-length recombinant KIAA1143.
Clone: 4E11
Isotype: IgG1 Kappa
Gene id: 57456
Gene name: KIAA1143
Gene alias: -
Gene description: KIAA1143
Genbank accession: NM_020696.1
Immunogen: KIAA1143 (NP_065747.1, 1 a.a. ~ 154 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSKRNQVSYVRPAEPAFLARFKERVGYREGPTVETKRIQPQPPDEDGDHSDKEDEQPQVVVLKKGDLSVEEVMKIKAEIKAAKADEEPTPADGRIIYRKPVKHPSDEKYSGLTASSKKKKPNEDEVNQDSVKKNSQKQIKNSSLLSFDNEDENE
Protein accession: NP_065747.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00057456-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (43.9 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00057456-M07-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged KIAA1143 is 0.03 ng/ml as a capture antibody.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy KIAA1143 monoclonal antibody (M07), clone 4E11 now

Add to cart