PLEKHG5 monoclonal antibody (M01), clone 5A9 View larger

PLEKHG5 monoclonal antibody (M01), clone 5A9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PLEKHG5 monoclonal antibody (M01), clone 5A9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,IF,S-ELISA,ELISA,WB-Re

More info about PLEKHG5 monoclonal antibody (M01), clone 5A9

Brand: Abnova
Reference: H00057449-M01
Product name: PLEKHG5 monoclonal antibody (M01), clone 5A9
Product description: Mouse monoclonal antibody raised against a partial recombinant PLEKHG5.
Clone: 5A9
Isotype: IgG2a Kappa
Gene id: 57449
Gene name: PLEKHG5
Gene alias: DSMA4|GEF720|KIAA0720|RP4-650H14.3
Gene description: pleckstrin homology domain containing, family G (with RhoGef domain) member 5
Genbank accession: NM_020631
Immunogen: PLEKHG5 (NP_065682, 896 a.a. ~ 995 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SAPSRSLSELCLAVPAPGIRTQGSPQEAGPSWDCRGAPSPGSGPGLVGCLAGEPAGSHRKRCGDLPSGASPRVQPEPPPGVSAQHRKLTLAQLYRIRTTL
Protein accession: NP_065682
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00057449-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00057449-M01-3-4-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to PLEKHG5 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5 ug/ml]
Applications: IHC-P,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Phosphorylation-mediated 14-3-3 Protein Binding Regulates the Function of the Rho-specific Guanine Nucleotide Exchange Factor (RhoGEF) Syx.Ngok SP, Geyer R, Kourtidis A, Storz P, Anastasiadis PZ
J Biol Chem. 2013 Mar 1;288(9):6640-50. doi: 10.1074/jbc.M112.432682. Epub 2013 Jan 18.

Reviews

Buy PLEKHG5 monoclonal antibody (M01), clone 5A9 now

Add to cart