Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PLEKHG5 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about PLEKHG5 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00057449-A01 |
| Product name: | PLEKHG5 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant PLEKHG5. |
| Gene id: | 57449 |
| Gene name: | PLEKHG5 |
| Gene alias: | DSMA4|GEF720|KIAA0720|RP4-650H14.3 |
| Gene description: | pleckstrin homology domain containing, family G (with RhoGef domain) member 5 |
| Genbank accession: | NM_020631 |
| Immunogen: | PLEKHG5 (NP_065682, 896 a.a. ~ 995 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | SAPSRSLSELCLAVPAPGIRTQGSPQEAGPSWDCRGAPSPGSGPGLVGCLAGEPAGSHRKRCGDLPSGASPRVQPEPPPGVSAQHRKLTLAQLYRIRTTL |
| Protein accession: | NP_065682 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |