NDRG2 monoclonal antibody (M06), clone 1D12 View larger

NDRG2 monoclonal antibody (M06), clone 1D12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NDRG2 monoclonal antibody (M06), clone 1D12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about NDRG2 monoclonal antibody (M06), clone 1D12

Brand: Abnova
Reference: H00057447-M06
Product name: NDRG2 monoclonal antibody (M06), clone 1D12
Product description: Mouse monoclonal antibody raised against a partial recombinant NDRG2.
Clone: 1D12
Isotype: IgG1 Kappa
Gene id: 57447
Gene name: NDRG2
Gene alias: DKFZp781G1938|FLJ25522|KIAA1248|SYLD
Gene description: NDRG family member 2
Genbank accession: NM_016250
Immunogen: NDRG2 (NP_057334, 1 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAELQEVQITEEKPLLPGQTPEAAKTHSVETPYGSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAP
Protein accession: NP_057334
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00057447-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.3 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00057447-M06-1-4-1.jpg
Application image note: NDRG2 monoclonal antibody (M06), clone 1D12. Western Blot analysis of NDRG2 expression in A-431 ( Cat # L015V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy NDRG2 monoclonal antibody (M06), clone 1D12 now

Add to cart