Brand: | Abnova |
Reference: | H00057447-A01 |
Product name: | NDRG2 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant NDRG2. |
Gene id: | 57447 |
Gene name: | NDRG2 |
Gene alias: | DKFZp781G1938|FLJ25522|KIAA1248|SYLD |
Gene description: | NDRG family member 2 |
Genbank accession: | NM_016250 |
Immunogen: | NDRG2 (NP_057334, 1 a.a. ~ 96 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MAELQEVQITEEKPLLPGQTPEAAKTHSVETPYGSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAP |
Protein accession: | NP_057334 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.67 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Chronic psychosocial stress and citalopram modulate the expression of the glial proteins GFAP and NDRG2 in the hippocampus.Araya-Callis C, Hiemke C, Abumaria N, Flugge G. Psychopharmacology (Berl). 2012 May 18. |